General Information

  • ID:  hor000759
  • Uniprot ID:  P23389
  • Protein name:  CCB peptide
  • Gene name:  CHGB
  • Organism:  Bos taurus (Bovine)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0016020 membrane; GO:0030141 secretory granule; GO:0030658 transport vesicle membrane; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  SAEFPDFYDSEEQMSPQHTAENEEEKAGQGVLTEEEEKELENLAAMDLELQKIAEKFSGTRRG
  • Length:  63(584-646)
  • Propeptide:  MQPAALLGLLGATVVAAVSSMPVDIRNHNEEVVTHCIIEVLSNALLKSSAPPITPECRQVLKKNGKELKNEEKSENENTRFEVRLLRDPADTSEAPGLSSREDSGEGDAQVPTVADTESGGHSRERAGEPPGSQVAKEAKTRYSKSEGQNREEEMVKYQKRERGEVGSEERLSEGPGKAQTAFLNQRNQTPAKKEELVSRYDTQSARGLEKSHSRERSSQESGEETKSQENWPQELQRHPEGQEAPGESEEDASP
  • Signal peptide:  MQPAALLGLLGATVVAAVSS
  • Modification:  T1 Phosphoserine;T8 Sulfotyrosine;T10 Phosphoserine;T15 Phosphoserine;T51 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides. The 16 pairs of basic AA distributed throughout its sequence may be used as proteolytic cleavage sites.; Secretolytin has ant
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P23389-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000759_AF2.pdbhor000759_ESM.pdb

Physical Information

Mass: 825473 Formula: C304H471N81O114S2
Absent amino acids: CW Common amino acids: E
pI: 3.9 Basic residues: 7
Polar residues: 14 Hydrophobic residues: 16
Hydrophobicity: -115.08 Boman Index: -18008
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 51.27
Instability Index: 8874.76 Extinction Coefficient cystines: 1490
Absorbance 280nm: 24.03

Literature

  • PubMed ID:  15174145
  • Title:  Characterization and location of post-translational modifications on chromogranin B from bovine adrenal medullary chromaffin granules